McDonnell Genome Institute

Washington University

CircRNA

chr9|14125631|14307520|-|NFIB|ENST00000380934.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

15

Peptide

LELHTVDEFHPFIEALLPHVR

Amino Acids from 5' Exons

ICLLRLLRSLKSHCSALHLHRILPQDALSPSTTIPEYLELHTV,YVFSDYYEEAKAIVQLCISTGFFPKTEHFPPAPPSRNTWSCTQ,MSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHS

Amino Acids from 3' Exons

DEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQ,MNFTHSSRHFFHMSVQLPILGSTCRLENASTLKSMRSECQRMKKEQSKMSFSVKSLKSNRSGHPGSLPNCAKIFARSIERTLCSPLARSTRAVSYPIPTRRVRLGESTACDRQTKSGVWISWSCSKASPWKVPMESGSNPHIAQTQHFVSSHIISQYQLRSLICFWHTTCRSK,ISPIHRGTSSTCPCNCLYLVQPAGSKTQVLKAEANVKGRKSSQRASQKANQTEVGIQAPCQTAQRYSPGVSRGLCAHRDWQEAPVLCLIQSRPEGDENRLPATGRQSLASGSSHGDPVQRHPLGKYRWRAAHEIPTLHKPSTLCPATSYHSISGAFVFGILRAGA