McDonnell Genome Institute

Washington University

CircRNA

chr9|14102421|14120624|-|NFIB|ENST00000397575.7

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

ICDWTMNQNGR

Amino Acids from 5' Exons

LRICDWTMNQNGRHLYPSTSEDTLGITWQ,GFVTGPIKTAGIYTPVPVRIHWELLGK,EDLLDHESKRQAFIPQYQGYIGNYLAK

Amino Acids from 3' Exons

SSQLELHLHLHRCHFQHKLSFLQPHRATFLIQQSDILPTILRILRTMYLLMTHPVHKPA,HLNSNSTSTFTVAISNTSYPSSSPIELLFSSNNQISSPPESSGYSEELCTFLPIQSTNQP,ISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQ