McDonnell Genome Institute

Washington University

CircRNA

chr9|137021391|137023052|-|ABCA2|ENST00000492260.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9959

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

ATCLTQR

Amino Acids from 5' Exons

ELLLAPALLEQLTCTPGSGELGRILTVPESQKGALQGYRDAVCSGQAAARARRFSGLSAELRNQLDVAKVSQQ,SCCWLLPSWSSSPARRARGSWAGSSLCLRVRREPCRATGMLSAVGRLLRVPGASLGCLLSSGTSWTWPRSPS,AAAGSCPPGAAHLHAGLGGAGPDPHCAESEGSPAGLPGCCLQWAGCCACQALLWAVCAPEPAGRGQGLPA

Amino Acids from 3' Exons

PSTQRRPRLPASCLSCNRCARTASETSSASCSTPTPRECPPAPRSTHPSPAHPVSDIRHGAGSRSCLSAWTAWWRKATCLTQRGPAWAQSSRPYASIWRPSVRARAPRGATWTDPQ,LLHSGAPDVCRHPACHAIAVPGRPARRVRLPAVRQLHVSAHPPLGAPTPPQPIQVTSAMVQGHAAAAPGPRGGGRQPVPSAAQPGLRARGPTPASGGPQCGPGHLGEPPGQIH,FYTAAPLTSAGILPVMQSLCPDGQRDEFGFLQYANSTVPTRPSEHPPLPSPSSEHPPWCRVTQLLERLDRVVEEGNLFDPARPSLGSELEALRQHLEALSAGPGTSGSHLDRST