McDonnell Genome Institute

Washington University

CircRNA

chr9|136862118|136862999|-|EDF1|ENST00000224073.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9006

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

RFPLAASSVLLTGR

Amino Acids from 5' Exons

ASSSGERTLESPSRRGLGRNEHKASKSVRSSSRSAGSPWPPVPFSSRAERNKGSSLRGTLPSPFLLSNKQNLAK,PQAPGKGHWKAHREGAGEMNTKPRNQCAPADLVPPVPLGRQFRSPHGPNGTRGPACGGPSPAHSCCQTNKTLQS,LKLRGKDIGKPIEKGPRAKTQSLEISALQLISFRRFPLAASSVLLTGRTEQGVQLAGDPPQPIPAVKQTKPCKA

Amino Acids from 3' Exons

KINEKPQVIADYESGRAIPNNQVLGKIERAI,KSMRSHRSRTMRADGPYPITRCLAKSSGPL,NQEATGDRGLERTGHTQPGAWQNRAGH