McDonnell Genome Institute

Washington University

CircRNA

chr9|136507954|136508385|-|NOTCH1|ENST00000277541.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9932

86

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

TWWTSAHPAPAR

Amino Acids from 5' Exons

VLTLPACASMEGSVWTRATRTTAAARRATQAATVRTWWTSAHPAPARTGPPARTTWAATPA,CRCPPVPAWRALCGRGQHAPLPLPGGLHRQLLGPGGRVLTQPLPERGHLHGLPGRLLLQ,VDVARLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCK

Amino Acids from 3' Exons

NLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQ,TLCTGVTPRPARTAANAGRPTPSTAASAPAAGPAFTATCPACPVRWLRSDK,PCALVLLALQERRQMLADPHPVPLRVPQRLDRPLLRRAQRVLGGCAAT