top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|134699908|134701333|+|COL5A1|ENST00000371817.7

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9828

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

MASSCLAPGSWMR

Amino Acids from 5' Exons

RLHFPRTSPSQLKPRKAARPSWSPSTTSRVSSRLGWSWAALPSSSTRTTRGSLARKTTPSSGASTCQMA,VCISRGLLHPNNCESQERQPGLPGLHLQRAGYPADWAGAGPLSRLPLRGPHGEAWPGRLPPLPGHQPVRWQ,SAFPEDFSILTTVKAKKGSQAFLVSIYNEQGIQQIGLELGRSPVFLYEDHTGKPGPEDYPLFRGINLSDG

Amino Acids from 3' Exons

VAQNCSQRPQEKCHLDPRLKEDHQIPRPQRPPHDRHQWHHRVWHPDPGGGV,WHRIALSVHKKNVTLILDCKKKTTKFLDRSDHPMIDINGIIVFGTRILDEEVFE,GTELLSASTRKMSPSSTVKRRPPNSSTAATTPSTSMASSCLAPGSWMRRCL

bottom of page