top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|134421675|134421805|+|RXRA|ENST00000356384.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9613

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

14

Peptide

SSCCGQPNDPVTNICQAADK

Amino Acids from 5' Exons

PNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRA,RTTLSPTFAKQPTNSFSPWWSGPSGSHTSQSCPWTTRSSCCGQ,ERPCHQHLPSSRQTAFHPGGVGQADPTLLRAAPGRPGHPAAG

Amino Acids from 3' Exons

PNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRA,RTTLSPTFAKQPTNSFSPWWSGPSGSHTSQSCPWTTRSSCCGQ,ERPCHQHLPSSRQTAFHPGGVGQADPTLLRAAPGRPGHPAAG

bottom of page