McDonnell Genome Institute

Washington University

CircRNA

chr9|134045292|134051709|-|BRD3|ENST00000303407.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9573

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

14

Peptide

LQPTDDIVLMAQALEK

Amino Acids from 5' Exons

RKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQ,GRWMAESTQTHRALLLMSGCSRIATNTIPQTTRLWPWPGSS,EDGWPRVPRRTGLCCCPADVLELLQIQSPRPRGCGHGPEAP

Amino Acids from 3' Exons

PTDDIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKPAAGAQSA,PQMTCWPKLRKFFYKKWPRCPKRKLNYYPLLQRAKVGSRLREPRAQ,HRHSANGPSFRENFSTKSGPDAPRGSIITPCSKGQRSEAGCGSPER