McDonnell Genome Institute

Washington University

CircRNA

chr9|13112023|13119649|-|MPDZ|ENST00000319198.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9974

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

TDAGRPDINGEWGRR

Amino Acids from 5' Exons

GPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLR,ALLTHWESASLEEAAHLVMCLYLLQCTQLELQHRPKNS,PYLTGNQHRWRSRQPTWCAYIYCNDAPNWSCSTDPKTQ

Amino Acids from 3' Exons

KRYWSICVRHCQRRNCRCRWKTDAGRPDINGEWGRRSCHPRSGCRFAK,NDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLK,TILEYLCQTLSKEELQMPMEDCRETRYWMGKTFVMPPKKRLPLC