McDonnell Genome Institute

Washington University

CircRNA

chr9|129098012|129098650|-|CRAT|ENST00000318080.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9692

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

22

Peptide

ACAVSPGAPAHAQEAAVQHHPR

Amino Acids from 5' Exons

DLRTGMCHLKCLPAHVSPGPHRHHPLGFHGLTHLCQGHGLQRH,IYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVT,STDRHVPPMKVPPCACFTWAAPTPSARLPWTHSPLSRPWMTPAS

Amino Acids from 3' Exons

EETRACAVSPGAPAHAQEAAVQHHPRDQERHREGQAEPQH,KKPELVRSPLVPLPMPKKLRFNITPEIKSDIEKAKQNLS,RNPSLCGLPWCPCPCPRSCGSTSPPRSRATSRRPSRTSA