McDonnell Genome Institute

Washington University

CircRNA

chr9|128845352|128847643|-|CCBL1|ENST00000436267.6

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9977

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

SAVPQGSGR

Amino Acids from 5' Exons

LAMAKQLQARRLDGIDYNP,SPWPNSCRPEGTGSTTTP,RHGQTAAGPKARRDRLQPL

Amino Acids from 3' Exons

SCVWGTQVLSSEAFSGQGCFLPSPLPLEKSAVPQGSGRHVQDCSSHLCAPGGAPSGKEGWSPTHLVLAPD,AVCGGPKSARRHFLARAVSSLLPCLWKSLQCPKALGGMFRTAAAISVHLVGPLQGRKAGAPLTWFLHQT,LCVGDPSPELGGIFWPGLFPPFSPASGKVCSAPRLWEACSGLQQPSLCTWWGPFREGRLEPHSLGSCTR