McDonnell Genome Institute

Washington University

CircRNA

chr9|128262562|128268524|-|GOLGA2|ENST00000421699.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9204

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

LEMTELLLQQTPK

Amino Acids from 5' Exons

PKQGPEAREIRIGREASGPSDEGWHAALGRIAKEVRDDGTPAST,QSNEDLKQEKSELEEKLRVLVTEKAGMQLNLEELQKKLEMTELLLQQ,KAMRTSKRNQNWKRSFGSLRRLACSLTWKNCKRSRRNSCFN

Amino Acids from 3' Exons

TPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQ,HPRTMLLLYNHLMTPCYLAVSLPLVPVSLAWRHL,TQGQCCYSTTIHRVTWRCPFPWCQSHHGGIS