McDonnell Genome Institute

Washington University

CircRNA

chr9|128257600|128258198|-|GOLGA2|ENST00000421699.6

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9247

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

17

Peptide

EEMKVAFFNSAVASAEEEQAR

Amino Acids from 5' Exons

ESTLHCTRARGQCRSGTGRRRSTSAGWPKTRRR,RVHCTVPEPEGSAEGAAPGEGGVHQQAGPRQGGDE,EYIALYQSQRAVLKERHREKEEYISRLAQDKEEMK

Amino Acids from 3' Exons

VAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLASAQKEPEAAAPAPGTGGDSVCGETHRALQGAMEKLQ,WHFSTQLPVPRRSRQGYVGSRSKGCAAGAWLTCWPRPRRSLRQQPQPQGPGVILCVGRPTGPCRGPWRSC,GIFQLSCSQCRGGAGKATWAAEGAKGALPAPGSPAGLGPEGAGSSPSPRDRGFCVWGDPPGPAGGHGEAA