McDonnell Genome Institute

Washington University

CircRNA

chr9|125238940|125239331|-|HSPA5|ENST00000324460.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9893

64

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

11

Peptide

SSTCTAAAIAYGLDK

Amino Acids from 5' Exons

YGSCYCLWPGEGGGEEHPGVPGWRNLRCVSSHHQWCLRSCGHWRYSSGWRRLPACHGTLHQTVQKEDGQRCQERQSCAETPARGRKGQTGPVFSASSKNNVLLRRRLFDPDSGQIRAQH,TAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNM,RQLLLLMAWIRGRGRRTSWCLTWVAEPSMCLFSPLTMVSSKLWPLMEILIWVEKTLTSVSWNTSSNCTKRRRAKMSGKTIELCRNSGARKRPNGPCLLSIKQELKLSPSMKEKTFLRPLGPNLKSST

Amino Acids from 3' Exons

YGSCYCLWPGEGGGEEHPGVPGWRNLRCVSSHHQWCLRSCGHWRYSSGWRRLPACHGTLHQTVQKEDGQRCQERQSCAETPARGRKGQTGPVFSASSKNNVLLRRRLFDPDSGQIRAQH,TAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNM,RQLLLLMAWIRGRGRRTSWCLTWVAEPSMCLFSPLTMVSSKLWPLMEILIWVEKTLTSVSWNTSSNCTKRRRAKMSGKTIELCRNSGARKRPNGPCLLSIKQELKLSPSMKEKTFLRPLGPNLKSST