McDonnell Genome Institute

Washington University

CircRNA

chr9|124908376|124921240|-|GOLGA1|ENST00000373555.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9161

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

LGDHVIASK

Amino Acids from 5' Exons

KTLAEQNLEDTRQQLLAARSSQAKAINTLETR,KHLLSRIWRIPDNSSWQPEAARLRPLTPWRL,NTCAEFGGYQTTALGSQKQPGGHHPGDS

Amino Acids from 3' Exons

RSCDSFKNRCRKDHSPGTKGTRAPSTHSAAFHFAK,DHVIASKTGAESKITALEQKEQELQALIQQLSIDLQK,IMLQKQVQKVRSQPWNKRNKSSKHSFSSFPLICK