top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|123076633|123090385|+|RABGAP1|ENST00000373647.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9555

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

DLDNTSK

Amino Acids from 5' Exons

TSKDDLLLTDFEGALKFFRVQLPKRYRSEENAKKLMELACNMK,LRKMTCCQTLKVPSSLGFSFLRDTAQKKMQKNWNPAT,FERPAVDRLRCLEVLGSASEIPLRRKCKKTNGISLQHE

Amino Acids from 3' Exons

RENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDN,GRIGVYKKLTGWNRKTMTPMSWPARLHYGRTWI,GEASTRSHEVGTGKRLSPAGDQQDCTTEGPG

bottom of page