McDonnell Genome Institute

Washington University

CircRNA

chr9|122879754|122883379|-|RC3H2|ENST00000335387.9

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.997

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

AMRPLSYAR

Amino Acids from 5' Exons

TLFHQLGSSWKMQWLLKQFMALWTSYKIIVEKAMRPL,RCFTNLGAAGKCNGSCNSSSWPCGLHTKLKRPDPS,AVSPTWEQLENAMVAVKTVVHGLVDFIQNYSRKGHETPQ

Amino Acids from 3' Exons

LCKKRPSWCYWHKMVLPSQGKFWYFLLCRDNQDFLRHQKQVLVMLCNYCIELLVL,YARRGLEAGVTGIRRWFCPLKESSGTFCCAETRTKISSGIKNKYWSCCATTVSSFLF,MQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFK