McDonnell Genome Institute

Washington University

CircRNA

chr9|122879754|122880125|-|RC3H2|ENST00000335387.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9457

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

9

Peptide

KGHETPQLQSPESFAK

Amino Acids from 5' Exons

TLFHQLGSSWKMQWLLKQFMALWTSYKIIVEKAMRPL,RCFTNLGAAGKCNGSCNSSSWPCGLHTKLKRPDPS,AVSPTWEQLENAMVAVKTVVHGLVDFIQNYSRKGHETPQ

Amino Acids from 3' Exons

LQSPESFAKSVQELTIVLQRTGDPANLNRLRPHLELLANIDPNP,YSLQSHLQRVSRNQLFCNEQVTQLTIDGLISFLQTTLIQ,TVSRVICKECPGIDNCFATNRPSLKTEASFRASCKHRPS