McDonnell Genome Institute

Washington University

CircRNA

chr9|120787768|120788278|-|FBXW2|ENST00000474117.1

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9118

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

DGLLCTGK

Amino Acids from 5' Exons

VNFSITLWRERTLRHGLITFLLHFFLRTCRKMKLWITLVVGQSSSGISPITRLSSSGTSSNSFPWSSVFICNGSILRLYSHAASSLNSGIRVPVQRCGRLHVKIWAGRMILFRTLCTGRRFIRLFESNWRTMKPLKPRHLDTVPECMHFTTKMDFSVQ,IFPPYGEKGLDMAHFCYISFSDGLAEKNSGSPDSEWGSPAQASLQPRDSPQAGLPQTPSPGAQFLFVKMARSSDFTHMLPRLTVEGDKCLYRGVADCMKFGLADRFCSGRFALEEGLFEGYFENEATGGPSLNLVINWTQCQSVCTLLQRWTSLY,KFFHNLMERKDFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLLPLELSFYLLKWLDPQTLLTCCLVSKQWNKVISACTEVWQTACKNLGWQIDDSVQDALHWKKVYLKAILRMKQLEDHEAFETSSLIGHSARVYALYYKDGLLCT

Amino Acids from 3' Exons

VNFSITLWRERTLRHGLITFLLHFFLRTCRKMKLWITLVVGQSSSGISPITRLSSSGTSSNSFPWSSVFICNGSILRLYSHAASSLNSGIRVPVQRCGRLHVKIWAGRMILFRTLCTGRRFIRLFESNWRTMKPLKPRHLDTVPECMHFTTKMDFSVQ,IFPPYGEKGLDMAHFCYISFSDGLAEKNSGSPDSEWGSPAQASLQPRDSPQAGLPQTPSPGAQFLFVKMARSSDFTHMLPRLTVEGDKCLYRGVADCMKFGLADRFCSGRFALEEGLFEGYFENEATGGPSLNLVINWTQCQSVCTLLQRWTSLY,KFFHNLMERKDFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLLPLELSFYLLKWLDPQTLLTCCLVSKQWNKVISACTEVWQTACKNLGWQIDDSVQDALHWKKVYLKAILRMKQLEDHEAFETSSLIGHSARVYALYYKDGLLCT