McDonnell Genome Institute

Washington University

CircRNA

chr9|120517756|120518645|-|CDK5RAP2|ENST00000473282.6

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9451

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

12

Peptide

LFLIEGSEDYETALSGK

Amino Acids from 5' Exons

GLTLFPGLFLNSWAQVILPPQFLELGLAHATMPTSLIVPDR,VSLCFLGCSTPGLKSSHLSFLSSWDYRHMPPCPPHLFLIE,SHSVSWAVPELLGSSDPPTSVSVAGIIGTCHHAHLTDCS

Amino Acids from 3' Exons

GSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIR,GLKTMRLLYQERKPFRLRCAHKTSPRVQRTTDCVEALRRSPRSVTCSRRGRDWRRTWRKPIERRAKETAPS,VRLDCSIRKGSPFGCAALTKPHQEYREPQTAKHEDHPGAELAAGEGETGEGPGGSPSREEQRRLHHP