McDonnell Genome Institute

Washington University

CircRNA

chr9|115073602|115082807|-|TNC|ENST00000341037.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9959

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

8

Peptide

ASTDLPAPEGLK

Amino Acids from 5' Exons

SWTRPRTFRFLKLQRPAPCSGRHRWPNLTATASITVSPQASGWECSFQETPLPMSEAWNQDRSTMSSQPRKADTRASPHVRHPL,VGHAQGPSGFNCRDQPDPALEDTVGQIPLPPQLQSPHRPVGGSAASKKHHFLCPERPGTRTGVQCPPDSRERQTQEQARTCEGIH,LDTPKDLQVSETAETSLTLLWKTPLAKFDRYRLNYSLPTGQWVGVQLPRNTTSYVLRGLEPGQEYNVLLTAEKGRHKSKPARVKAST

Amino Acids from 3' Exons

TYLHLKANSSPSRRHLWKWSGILTLLLKPGRSSSGI,LTCTRPEIQVHQGDICGSGVGSSRHCFNLGDHLPEY,LPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNM