McDonnell Genome Institute

Washington University

CircRNA

chr9|115062916|115082807|-|TNC|ENST00000350763.8

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9314

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

8

Peptide

GHSTRPLAVEVVTDLPAPEGLK

Amino Acids from 5' Exons

RRFQIWETSQPRLAGMLSDTGPRQMEPMTSLLFRSRRLTRWKRLTISRFLAACVPWKSQASGLALLTQSPCTARSGATALDPLLRSSQ,GGSRYGKPHSDRGLGCSQTELDHARWNLPVYYSGPGGPGGRGSQSHGSWQPAFHGNPRPQGWHSLHSHPARRGQGPQHSTPCCRGRH,EVPDMGNLTVTEVSWDALRLNWTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSMEIPGLRAGTPYTVTLHGEVRGHSTRPLAVEVVT

Amino Acids from 3' Exons

TYLHLKANSSPSRRHLWKWSGILTLLLKPGRSSSGI,LTCTRPEIQVHQGDICGSGVGSSRHCFNLGDHLPEY,LPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNM