McDonnell Genome Institute

Washington University

CircRNA

chr9|115046409|115064068|-|TNC|ENST00000341037.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

19

Peptide

SQTVSAIATTGETPNLGEVVVAEVGWDALK

Amino Acids from 5' Exons

KPNRKLTTFWFQMPPQTVSVCPGQLMKGSSTILFSKSEIPKSSLSHWKPYLPPNVPGTQVSERLLNTKLNSMEAKEGDPRQSVLQQQ,SRTGSQPSGFRCHPRRFPSVLDSRGLRQFCSQNQRYQKAVATGNNPTCPRTYQGHNRSQRGYIRNTLWNKQRKAIPDSQCYSNN,AEPEVDNLLVSDATPDGFRLSWTADEGVFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGLREATEYEIELYGISKGRRSQTVSAIATT

Amino Acids from 3' Exons

GKLPIWERSWWPRWAGMPSNSTGLLQKGPMSTFSFRCRRLTQRQPRTSPSQEDGPQTCLGSKQPLIIPSPSAGSLRTSAQPLSLLKSQ,GNSQFGRGRGGRGGLGCPQTQLDCSRRGLVLFHSGAGGHSRGSPEPHRPRRTEVHRPAWAQSSHSLYHHHPRGHSGLQHNPSLCSLD,ETPNLGEVVVAEVGWDALKLNWTAPEGAYEYFFIQVQEADTVEAAQNLTVPGGLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLT