top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|112438430|112441770|+|HSDL2|ENST00000398803.1

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9564

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

21

4

Peptide

VESTAIHTAAMDMLGGPGIESQCRK

Amino Acids from 5' Exons

PYTLLLWICWEDLVSKASVEKLISLQMQHIPFSKSQKVLLATLSLMKISKKKEKILTFMQLNQ,HTHCCYGYAGRTWYRKPVKSYHCRCSIFHFPKAKKFYWQLCHKYLKRRRNRKFRLCNT,IHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKP

Amino Acids from 3' Exons

VILCNQISSMNTQKQLARKWNQL,SSFATRFLLRIPRSSQESGIN,HPLQPDFFLDEYPEAVSKKVEST

bottom of page