top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|112268048|112276013|-|PTBP3|ENST00000210227.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9154

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

7

Peptide

TDNLPNQALMGMTAR

Amino Acids from 5' Exons

AFLEMASEEAAVTMVNYYTPITPHLRSQPVYIQYSNHRELKTDNLPNQA,LSKWLLRKLPLLWIITLLLLLTFEASLFIFSIPITENLRLTIYLIK,FLRNGFGSCRYYGELLHSYYSSPSKPACLYSVFQSQRTDQSTSS

Amino Acids from 3' Exons

LMGMTARNLNEIDLPVRLPVFSIFEKFHVMSPKQRSYHVYHLAKLIFCKEKA,WEQQEITRTSLFAFPCSPSSKNSMCHRSRDHIIRSTIWQSNSFDVERKKP,NGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQ

bottom of page