McDonnell Genome Institute

Washington University

CircRNA

chr9|112234819|112262599|-|PTBP3|ENST00000334318.10

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9405

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

MQGLLDLPQPLDFLK

Amino Acids from 5' Exons

VHRVFLHHMQGLLDLPQPLDFLKLQ,CTGYNFFTICRGCWICPSHWISSSY,APGIISSPYAGAAGFAPAIGFPQAT

Amino Acids from 3' Exons

RAQAALQAVSAVQSGSLALSGGPSNEGTVLPGQSPVLRIIIENLFYPVTLEVLHQ,EPKLHCRLSVPSNQEAWPFLEVLPMKAQSYLGRALCFELLKTSFTLLPWKFFI,SPSCTAGCQCRPIRKPGPFWRSFQRHSPTWAEPCASNNYKPLLPCYPGSSSS