McDonnell Genome Institute

Washington University

CircRNA

chr9|111442305|111451555|-|KIAA0368|ENST00000259335.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9617

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

NNVNWPLR

Amino Acids from 5' Exons

NFTIIYVKMGYPRLPVEKQCELAPTLLTAMEGKPQPQQD,ILLFMLKWAILAYQWKNNVNWPLRFLLPWKGSLSHSRI,FYYNLCNGLSSPTSGKTMTGPYASYCHGREASATAG

Amino Acids from 3' Exons

ISLNGSFYDLAMLKQMNNYRILYLNSFLLFCSNSLAPKKEYVK,SATGLFTTWPCNRTITEYYIIPSSCFAQTLHPRRSTK,QLERVFLRLGHAETDEQLQNIISKFLPPVLLKLSSTQEGVRKK