McDonnell Genome Institute

Washington University

CircRNA

chr9|111433232|111440521|-|KIAA0368|ENST00000259335.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9785

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

13

Peptide

QSLMHLLIPTLFHMK

Amino Acids from 5' Exons

CKLGIVKFIEAEQVPELEAVLHLVIASSDTRHSVATAADLELKSKQ,ANWESNSKLNRCLNLKLFSTWLPLVIHATVWQRQQTWNKANR,QIGNREIHRSTGATSCSPLGDCLYTPQCGNGSRPGIEKQTE

Amino Acids from 3' Exons

LNASFNTNPFSHEIPCIIKISFSISCETKDCAAAFGLHARCPSDALW,LMHLLIPTLFHMKYPVESSKSASPFNLAEKPKTVQLLLDFMLDVLLMPY,CIFYQPFFTNTLLNHQNQLLHLILLRNQRLCSCFWTSCMSFCLM