McDonnell Genome Institute

Washington University

CircRNA

chr9|111428041|111451555|-|KIAA0368|ENST00000259335.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9476

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

14

Peptide

QAAETFPANIQISLNGSFYDLAMLK

Amino Acids from 5' Exons

GAVLKPELKRDPVSTRVKLKIVPHLLRSRQAAETFPANIQ,VQFSQSKGTLSVQESSRLSPISSALDKLLKRSQPTF,CSSEARVEKGPCQYKSQVKDCPPSPPLTSCNVPSQHS

Amino Acids from 3' Exons

ISLNGSFYDLAMLKQMNNYRILYLNSFLLFCSNSLAPKKEYVK,SATGLFTTWPCNRTITEYYIIPSSCFAQTLHPRRSTK,QLERVFLRLGHAETDEQLQNIISKFLPPVLLKLSSTQEGVRKK