top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|109931926|109943381|+|PALM2-AKAP2|ENST00000413420.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

TAEPSPGQDGTSR

Amino Acids from 5' Exons

MQITFPPSFPTCQSSVHEQQNHHLGRTGPAERL,CSKLHFLPASRPANPLFTNSRTITWAGRDQQSG,AVNYISSQLPDLPILCSRTAEPSPGQDGTSRAA

Amino Acids from 3' Exons

LCTPWKLMWRKTNKQERPRFSLHLPLAQRGSIRKESKSMMMVPKCMRCAQEAPKMECTNAQRMKSLFRRLDNQAEEGTCLKGLLQMGASAIPRNTCSAKKLSKWYISLGKTILPGTQGSRPKPPALQGRRQTWISPSPFLWATKISRMKRRRKRCAMMKPSRLNWSSLMKMMRSHGRRQRTCPLLTGTRLSLCPGGRSQTPQSPHPQKGRKRALQSQPQ,CVRHGNCGERQTNRRDQDSLYIYHWPRGGPSERSQSLWYQSSVGALRRHRSRKWSAQIKHKGCRRAYSEGWTIKLRRRARVKDCDCRWEPQPSQGTHALQRSVRNGTVERPFFREPRAAGPSPQRCRAGGKLGSARHHDFYGLPKYRGRGDEKGARLNHQGIGPHREVIEGEDSDGRVHYRERGACVREAGLRHHRALIPRREGREPSYRASP,VYAMEINVEKDKQTGETKILSTSTIGPEGVHQKGVKVYDDGTKVVYEVRSGGTVVENGVHKLSTKDVEELIQKAGQSSLGGGHVSERTVIADGSLSHPKEHMLCKEAKLEMVHKSRKDHSSGNPGQQAQAPSAAGPEANLDQPVTMIFMGYQNIEDEEETKKVLGYDETIKAELVLIDEDDEKSLREKTVTDVSTIDGNAAELVSGRPVSDTTEPSSPEGKEESLATEPAP

bottom of page