McDonnell Genome Institute

Washington University

CircRNA

chr9|109426949|109463451|-|PTPN3|ENST00000262539.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9192

29

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

SYSAIVMTSR

Amino Acids from 5' Exons

AESREHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTK,LNPGNILWPSTCITDLAKTCGNPVLSTIRSFRQRSYYLRKRMFCLSTGLWALGTPK,IQGTYCGLQHAELPILQKLVEILCAPYVLSGKEATTSGKECSVSVLDYGLSEHQK

Amino Acids from 3' Exons

VIQRLPPGYVRWVEELIIYAPRSYPKRKLDQKSFAASTFMAWYRPLKL,LFSDSYDLPVTCVGWKNYTHLGVTQRENSIRSHLQHPLFRWRGTDLSY,YSAIVMTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVT