McDonnell Genome Institute

Washington University

CircRNA

chr9|108972674|108979481|-|CTNNAL1|ENST00000325551.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9614

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

7

Peptide

EQLVEMNIEALR

Amino Acids from 5' Exons

LHSTATQLAADLLKYHADHVVLKALKLTGVEGNLEALAEYACKLSEQKEQLVE,FIVQRHSWQQIYNTMLIMWFKHNLLEKEIKLWLNMPVNSLNRKSSLL,SYSDTAGSRSIKIPCSCGSKSIKTYWSRRKFRSFGICLTLTERAAC

Amino Acids from 3' Exons

MNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELSTQARMELQQLISVWIQA,ILKLFGRIFIFSPKRTFLHWKSSWSVWRTLLILPTPAMSTENASWNCQLRREWNCSSFLCGFK,EYSSSGESLFSVQREPFCDIGSHLGAYGGLYFCLHQPAQRTHLGTVNSGENGTAAVNFCVDSS