McDonnell Genome Institute

Washington University

CircRNA

chr9|104840278|104840519|-|ABCA1|ENST00000374736.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9377

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

RTTTTKPSLEAMALR

Amino Acids from 5' Exons

LFSMRSWSDMRQEVMFLTNVNSSSSSTQIYQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNGTEEDAETFYDNST,CSAEAGVTCDRRCFPMTAPAPPPKSTRLCLVLSAGIPREGGRSSLSTGMRTTTTKPSLEAMALRKMLKPSMTTLQ,VQHEKLEHATGGDVSDQCEQLQLLHPNLPGCVSYCLRASRGRGAEDQVSQLVGQQLQSPLWRQWHGRCNLLQLY

Amino Acids from 3' Exons

LFSMRSWSDMRQEVMFLTNVNSSSSSTQIYQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNGTEEDAETFYDNST,CSAEAGVTCDRRCFPMTAPAPPPKSTRLCLVLSAGIPREGGRSSLSTGMRTTTTKPSLEAMALRKMLKPSMTTLQ,VQHEKLEHATGGDVSDQCEQLQLLHPNLPGCVSYCLRASRGRGAEDQVSQLVGQQLQSPLWRQWHGRCNLLQLY