McDonnell Genome Institute

Washington University

CircRNA

chr9|104793170|104831827|-|ABCA1|ENST00000374736.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9814

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

LGLGGTKPLR

Amino Acids from 5' Exons

GRIALCHHYLGTWWDETSSPWPWKGWCSSSLLFSSTDSSSGP,GESLCVTIILGLGGTKPLRHGRGRGGVLPHYCSDPVQILHQAQ,ENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRP

Amino Acids from 3' Exons

CVNLNKLEPIATEVWLINKSMELLDERKFWAGIVFTGITPGSIELPHHVKYKIRMDIDNVERTNKIKD,VSTTSNPQQKSGSSTSPWSCWMRGSSGLVLCSLELLQAALSCPIMSSTRSEWTLTMWRGQIKSRM,CQPEQARTHSNRSLAHQQVHGAAGEEVLGWYCVHWNYSRQHAAPSCQVQDPNGHQCGEDKNQGW