McDonnell Genome Institute

Washington University

CircRNA

chr9|101429754|101430897|-|ALDOB|ENST00000374855.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9662

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

21

Peptide

TCHHGPPISSPHPGAEEGALR

Amino Acids from 5' Exons

VPWGTACRGSRWKTLKRTAGSSEKSSSLWTVPSTRASGVSFSTRPSTRRTARESCSETSSRKRGSWWES,YHGEPPAEDQGGKHREPPAVPRNPLLCGQFHQPEHRGCDPFPRDPLPEGQPGKAVQKHPQGKGDRGGNQ,TMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIK

Amino Acids from 3' Exons

TCHHGPPISSPHPGAEEGALRNCPEHCCQWKGDPGCRIC,PVTMAHRFPALTQEQKKELSEIAQSIVANGKGILAADESV,LSPWPTDFQPSPRSRRRSSQKLPRALLPMERGSWLQMNL