McDonnell Genome Institute

Washington University

CircRNA

chr9|100326301|100330169|-|TEX10|ENST00000374902.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9023

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

3

Peptide

LSSSLAAMLIGILHMSIK

Amino Acids from 5' Exons

IHKKVLWWFSLQTLSSVWFSLYISYPVCRLICFLGVVAVLWEDSVQVWLPCLSGYCT,STRRCCGGSPCRLSAAFGSACIFPTQSAGFAFSVKSLLYYGKTQFKFGCHAYRDTAHE,PQEGAVVVLPADSQQRLVQLVYFLPSLPADLLSRLSRCCIMGRLSSSLAAMLIGILHM

Amino Acids from 3' Exons

HQALHSSLQHRSSLTEFNTVYHGLPGKCVNFAEGLQLDRNDKEICNRDPRWLAKATEQIAGSILEVNANTAKQ,IKHCTVLSNNIDHLLLNLTLSDIMVSLANASTLQKDCSWIEMIRKFVTETLEDGSRLNSKQLNRLLGVSWRLMQIQPNR,SSIAQFSPITIISYIHCLISWSPWQMRQLCRRIAVGKGNLQRPLKMALGIVSNTDCWEYPGGCKYSQTE