McDonnell Genome Institute

Washington University

CircRNA

chr8|80687225|80821615|-|ZNF704|ENST00000327835.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9939

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

REMTFTFQSEDLK

Amino Acids from 5' Exons

RASADPGRRAAACLPAPAAAATGAGAPPATSPTRPRRRRRSRLTASSPSAAPRSQTTASTRRRPATCSSTSPFPGKE,EPQRILEGGRLRAFQHQQQRLLELERPQRPVQPVHAVAAALGQLQALPQPRAARRRHRRGGGQQPALRRAHSQEKK,SLSGSWKEGGCVPSSTSSSGYWSWSAPSDQSNPSTPSPPLSADSFKPFRSPAQPDDGIDEAEASNLLFDEPIPRKRK

Amino Acids from 3' Exons

VGSIKREMTFTFQSEDLKRDCGKKMSHQHVFSLAMEEDVKTADTKKASRILDHEKENTRSICLLEQKRKVVSSNIDVPPA,WGALSGKPSHFSQRTNVTVVKKCLINTCFPWPWRKMKQQTPKKPAGSLTMKKKTLAPSVSLSKKEKLFPPTLMFLQQ,GEHAGNDLHISVRGLKTLWKNVSSTRVFLGHGGRCENSRHQKSQPDPPKRKHSLHLSPAKKKSCFLQHCSSSK