McDonnell Genome Institute

Washington University

CircRNA

chr8|73688653|73739868|-|STAU2|ENST00000355780.9

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9971

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

DFSLLFK

Amino Acids from 5' Exons

MFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNP,CSQCSVLVSRHGNPKAAVRRLSRLLPIKLLNLRFPNQFRSHPKVMLTITQ,VLSAAESWADMGIRRQQYKEGSAGCCQSFDIYASQTSSEATQKCQP

Amino Acids from 3' Exons

RLPTTRTLAYFLKIEEKKEDRKRRTQRYTKFEPRLR,GCLPQGLLTFRLKKKKKTEKEELKDTQSNLNQGSE,AAYHKDFSLLFKDRKKRRQKKKNSKIHKVITKAQK