McDonnell Genome Institute

Washington University

CircRNA

chr8|67266005|67277457|-|ARFGEF1|ENST00000262215.7

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9903

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

4

Peptide

EIIEQGIDLYGRR

Amino Acids from 5' Exons

VRKNPQSKRVKSNTLRQTDTEVIPWSQHHHQEAATVHRCLALIIQNNLRSSNKKKNKGI,SGKTLRARDENQTPDNKQIRKFKFPGVNIIIRNRQLQYTDVWHSRTIGPKATKRNNRTRDRF,QEKPSEQEMSEIKHPETINRYGSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGID

Amino Acids from 3' Exons

IWEKGLLMQVQMATLELRMVVTVKIFKQMEFQEHQFLLHIHHPYLMIDCQSLPMIL,YGRRDYYKCKCRWQHWNYRGWQKYSSKWNSRNTNFCCIYTILTIVSLFQYS,MGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQ