McDonnell Genome Institute

Washington University

CircRNA

chr8|67238342|67238893|-|ARFGEF1|ENST00000262215.7

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9288

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

DQAPDEFVGLGLAGER

Amino Acids from 5' Exons

ILKCISQLELAQLIGTGVKPRYISGTVRGREGSLTGTKDQAPDEFVGLGL,FSASVSWSWHSLELENLDTFLEQCEAEKDLLLEQKIRLLMNLWVG,SEVHQSVGAGTAYRNWSETSIHFWNSARQRRISYWNKRSGSICGFRA

Amino Acids from 3' Exons

LERDAYVQALARFTLLTVSSGITEMKQKNIDTIKTLITVAHTDGNYLGNSWHE,WREMHMSRHQDLPYSQVPVLLKNRRTLTQKHLSQWLIQMEIIEIHGM,GERCICPGTSKIYLTHSEFRYYNETEEHHNKNTYHSGSYRWKLFRKFMA