McDonnell Genome Institute

Washington University

CircRNA

chr8|67051229|67058211|-|COPS5|ENST00000357849.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9232

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

YWVNTLSSSSLLTVGR

Amino Acids from 5' Exons

ILCLRSLIFQILFGSQIAAVVEILGEYVEFFLAY,YYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLT,IMPKSHISNPLWIANCLSCCGINTGIRVLLACL

Amino Acids from 3' Exons

VGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVV,LAALKMQSGGIIATLAMAAGFLGLMLVLRCSISSSRNHLQW,WPPKCNRVVSPPWLWLLAFWDCYSDAQSAVPGTICSSG