McDonnell Genome Institute

Washington University

CircRNA

chr8|67045811|67062024|-|COPS5|ENST00000521509.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9222

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

KSVELVMLLPYLNSILK

Amino Acids from 5' Exons

NADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRD,MQTIPLVRSLICLKSSSQKPSWDEGVSCWVKRMTENQKTNLPKLQET,CRLYHWSGLFVKVRAVRSPAGTREFHVGFRNAPKIRRQTCQSYKRQ

Amino Acids from 3' Exons

RRQLLRFLGDGGVRERYGPENLGTGQQHAGSSEYRNLQIRQETAARNPGGEALDGVRRSLARRRGGKGWRSLRDPEGEGGERGEELSPTGRGTEYASWICKSLSPPLGLSLPFLSLSICPRVMGENNKRFKLSLLNIRIVIYATHPTLSPVSTCTLFGSSTNPKLGIAAVFRNRVSSPRSQKLAIFFSFFFNRNGSSLCCSGSRASAFKRSSRLRLPKCWDYRREAWAYNSFLIAGNYFGGTRRLYYLVSKMLLHQFPARNYKNRADLLPFNNIHFSLGVVTSRGIFTHNIYLFLRASPERFPAIRKRLLRVMFESKKSTKANGIERKAVVNKRTYFYCLTVFFTRLALSLSIQIPQWTAEAPSRFPRHLIFMTTQYSISILLLQIKKQANTLCNLSYHKTLNAIVRPKIKSHSCHLVDPEIYLSIFICHNMEIRPTYWYCHRDVRCIKRVVNVCNRSTVTCLSSFLQREKPRFRFMSLPTGLHIFQLLVEIWQSLGIKFGFFLWADIKGFVETLTDCSVRLLKLLGYLLASVTGCAFVRVLLNIWKLLACLTVLWLLYSSLSWAALMRPKCNFIQEFNSLMTNSEIVIIGDDIRATFFKADITGKPTLQHSVLEGETGCQLALIRVLVCVRHALYIHYFIYFILTTIMNIPIYRKGNLGTDITGLSQYHSGMAMSRFRPQMNVRTHILNHARRLGLRTVRHNHPSSQNPRLGDSKLMEKKSVELVMLLPYLNSILKKYFRLFPSPKGDTLLHYDILIVSSLQKLSFFTFSPRSLHSLSIALNSFNTYSLSSKLFNFTLYKEFNYIVILFCSHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQ,DDNFSASSAMAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKEGGPWRDAGEGKGGGVETQREREVKGVKSFHRLGGGQNMRLGSASRAALRWGFHSPFCRFNPFAPGCKGRTTSGDLSCHFTSVLSYMPHTLPAQCRHAPCLGLQLIPNWGLQLFSEIESAAQGLKNSYELFSFLFFLIEMGPRCVAQADLELLPSSDPPAFAFQSAGITGVRPGPIIVFLLVIISEAHGGSTTWSLKCYSTSSHKPEIIKIELKTFCPSTISIFPWEWQVEGSLPIIFIFSEHLLRDFLLSGKDNYYGLCLRVKRARKLMVRKGKLWSTRGHTSTASQFFLQGPCLSVFRFHNGELRKHLARDFHVIFSQPSTVYPSFCYKLKNKQIRYVIYDHTDISELSTEQSDLRSNLTAVTNLIDLRKFTYPSSFVIIWKDLLIGIVIEIRDNVKESSRMYVIGAQLVFLLFSSKGRSQDFDSCLDFQHEVYTFFSFWLKSGKAELNLDSFCGQTSKKALRRLTALGCLSCLVICLLLQAVHFRFVYSIFGNCWPASLSNCGSNYIHPSCLGLHDQNVILFKSLIHPTLKSETRILGLLFNLRLIQGSPPFNTLFFESRVKRQVNNADNSHLLGFYVGTKHFIYIISFISSQQLISLFTEKETAQILQGCPNTTAREWQCQDSDLSRMSEPTFLTIRPEGASEQLGTTIQAVRIQDWVIPNWRKSLLNWSCYSLIIAYKSISDFSPPLRGIRCCTMTYLLFPACKNCPFLLFLPVVYTPFPSLIPSILTLYLHKNFSEILLYIRNLITLFCFAVTITLSTAKSQHWLCRWCMPDREATWKWVCERWMVKPSLWTVLLCLWRALKPEMLRLLHMNTWLHTKMQN,TTTSPLPRRWRRPGAVWPRKPGNWPTTCRKLRVSMKSTNTTRNSSKKSWRRSPGLRSEEVPGETQGRERVAEFKRPRGRGRKGRAFTDWEGDRICVLDLQVEPKPSAGAFTPLSVALIHLPPGDVRGEQQAVIVVTSEHPYCHICHTPYLEPSVDMHLVWVFNSQTGDCSCFQKSSQQPKVSKIAMSYFLFFFFKWVLAVLLRLISSFCLQAILPPSPSKVLGLQAGLGLFFDCWLFRRHTEALLPGLNVTPPVPISQKLKSLRPFALQQYPFFPGSGDKSRDLYPYLSFPESISEISCYQEKIIITGYVEKEHESWLDRKESCGQQEDILLLPHSFFYKASLVSQYSDSTMVNCGSTLEISTSFNFHDNPVQYIHPFVTNKTSKYVMFMIILTVNSQLSNSQTDQISQLSLTSLTLGNLLIHLHLSYGNKTYLLVLSRLGEIMYKKSRLECMEHSNLSFFFSPVKGEAKISIHVLTSNMRSTHFSAFGNLAKLRNIWILSVGRHLKRLCRDVDLLCKAAVAWLSACFCNRLCILGSCTLKYLETVGLPHCLIVALIIFILAVLGCINETKMFYSRVFTDDQLNSDHRRLGYGYFLIGYNREAHPSTLCSLRVGLRDRLIMLITASTYGSSMCKALSTLYTLFHLFHPNNNYEYPYLQKRKPRHRYYRVVPIPQLGNGNVKIQTLADECQNPHSPLGQKVRPQNSAQPSKQSESKIGFQINGEKVCTGHVTPLFEHIKKVFQTFPLPGGYVAALHTYCFQPAKTVLFYFFSPSTLPFHRSKFLQYLLFIFIKTFLKFYFIGILHCDFVLQSPLLVLQNLSIGSAEDGDACQIGRQLGSDGSDARKGGWNHDHYGQFCFACGGHNPSKCSGCCIIHGCIHRKCKT