top of page

McDonnell Genome Institute

Washington University

CircRNA

chr8|55795977|55813118|+|TGS1|ENST00000260129.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9928

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

FSDFLRR

Amino Acids from 5' Exons

IWWNPKFQSSAGQVFREECEAVVPRHAQTNKDEKQTHLLYQRVRKTIFQEKQNSE,YGGIPNFSHRQVRYLEKNVKLKSKYLDMRRQIKMKNKHIFFTKESEKPFFKKSKILSK,MVESQISVIGRSGIRRMSLSLSTTCADKRKTNTSSLPKSQKNHFSRKAKFV

Amino Acids from 3' Exons

LNFQTFEDHYCLFSSKKCYP,FEIFRLSKKITNNIVYFLPRNADIDQ,LKFSDFLRRSLIILFIFFQEMLILT

bottom of page