McDonnell Genome Institute

Washington University

CircRNA

chr8|52676368|52684013|-|RB1CC1|ENST00000025008.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9848

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

LTHVADLK

Amino Acids from 5' Exons

EMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQSIEDIKLKLT,KCMKLPRNFVLFVKVLYMMNIFNTKAGLQSWPTWRTVQIHTKSYFSSLKVFIQIICSPKTSSNLL,NVSCQETLFFLRSCTTSSTPRLGCNHGQPGGLFKFIPKATFQVKYLFKLSAVHRRHQVKTYS

Amino Acids from 3' Exons

CGRPACHSKQIQDCYSTPGAGGQWRRMHGCRSKSVYLQCWD,VADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVCTYSAGT,WQTLSMPFKANTRLLFNTRCWWSMEENAWLQIEECVPTVLG