top of page

McDonnell Genome Institute

Washington University

CircRNA

chr8|47967364|47973064|+|MCM4|ENST00000262105.6

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9958

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

11

Peptide

LSEEASQALIEIK

Amino Acids from 5' Exons

IKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVT,SSFRSLRKTCLQGRHHTQLSCLLTMISLTRSSLGTEMLQ,QASGVSGRHACRADTTHSYPVCSQSRQGPAWGQSECY

Amino Acids from 3' Exons

VFDLPLAGPSGRSLQASGSPPGRTVLPERGAGRGGAPGHGGAKGLHCLRAQHHHAAAKGSQPGSHR,FDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIE,LISSSCWTLRTKPMTGVWLTTWSHCTTRARSRQRRSSWTWRCRTTLPTRTAPSCRGVRKPARLSS

bottom of page