McDonnell Genome Institute

Washington University

CircRNA

chr8|47893138|47930012|-|PRKDC|ENST00000314191.6

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9093

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

7

Peptide

TVGALQVLERFSLRNK

Amino Acids from 5' Exons

ATDPLICGKMFSRKKVSLFSSTPLRGVAVASPRASWPSPPSCTFGGHSACRPRYAGWTCSWPRWSATTRSLARELERSRS,QQIPFVAERCSQGRRCLFSHQHLGGWLWPALGHPGPAHPLVPSGAIQPAGHAMLAGPAPGRVGVLQHVHWRENCRSAPGP,NRSPNLWLKDVLKEEGVSFLINTFEGGGCGQPSGILAQPTLLYLRGPFSLQATLCWLDLLLAALECYNTFIGERTVGALQVL

Amino Acids from 3' Exons

RDSPETSRIFTMGVLIFIINFAIYKVAPHQWFLQIAFYYSKKCQENKIFR,EILPEKQAEFFEPWVYSFSYELILQSTRLPLISGFYKLLSITVRNAKKIKYFE,RFSLRNKQNFLNHGCTHFHMNFCNLQGCPSSVVSTNCFLLQEMPRKNIS