McDonnell Genome Institute

Washington University

CircRNA

chr8|47839147|47840189|-|PRKDC|ENST00000314191.6

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9066

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

4

Peptide

DVLIQGLIDENPGLQDDER

Amino Acids from 5' Exons

RSRKDRLPGNIVGKRCADSRIDREPWTS,DPESETDNDSQEIFKLAKDVLIQGLIDENPGL,IQKVRQIMTPRKYLSWQKMCFKDSMRTLDF

Amino Acids from 3' Exons

RKTKSMFGHNLDDAKVKTSRTPRTSEPRCGIRFPSFYNMGTNVYSHVDSLQ,DDERQKVCLDIIYKMMPKLKPVELRELLNPVVEFVSHPSTTCREQMYNILMWIHDNY,MMKDKKYVWTFIRCQSNQNSENFTPLWNSFPILLQHVGNKCIIFSCGFMIIT