McDonnell Genome Institute

Washington University

CircRNA

chr8|47798236|47803480|-|PRKDC|ENST00000314191.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

8

Peptide

ENNFSLAMK

Amino Acids from 5' Exons

LLILQNCRRIQHLWWRKCKLNIPMKPDSFLDYFRLNGIQRRLASQK,YFCRTAGVSSTCGGENVESFKIKFQSQIEVSITSDYRTVSRGDFEPHDKR,IDSAELQAYPALVVEKMLKALKLNSNEARLKFPRLLQIIERYPEETLSLMTKE

Amino Acids from 3' Exons

NNFSLAMKLLKELHKESKTRDDWLVSWVQSYCRLSHCRSRSQGCSEQVLTVLKTVSLL,TISHLLNYRSCIKSQKPETIGWAGCRATAAATAGAGPRAALSRCSLCKQSLCW,QFLTCYETTEGAARVKNQRRLAGELGAELLPPEPLPEPVPGLLAGAHCAENSLFV