McDonnell Genome Institute

Washington University

CircRNA

chr8|41684543|41719858|-|ANK1|ENST00000265709.12

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9573

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

RHHPGPPDPTPR

Amino Acids from 5' Exons

WRICTQPCRALTVARSTCWRVPADRAATSQTGGTPTATTRCHPPRM,GESVHSPAEHPWRDREHAGGFRPTEPQLEARQAAHRPRLLAVTLPDE,ENLYTALQSIDRGEIVNMLEGSGRQSRNLKPDRRHTDRDYSLSPSQMN

Amino Acids from 3' Exons

NGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRAL,TACPQFTWRLRETTSTVSGSCCNTTQRTTSPWTTPHSTWLPTVDTTGWLRSFWIKGPNPTPEP,RPVPNSHGGSGRPPRLCPAPVAIRRRDRRHHPGPPDPTPRGCPLWTPQGGGPSGRGQTQLQSP