McDonnell Genome Institute

Washington University

CircRNA

chr8|38242249|38253718|+|DDHD2|ENST00000397166.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9945

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

AIYATVNDFR

Amino Acids from 5' Exons

LMIFAVFPTCYRHILRKPKKISRLGGNFFQSTGTVLCILLVWM,FSQCFLELATDTFESPRKSADWEGRISSSQLAQSFAFYWCGC,NDFRSVSLNLLQTHFKKAQENQQIGRVEFLPVNWHSPLHSTGVD

Amino Acids from 3' Exons

MLTQKRPLWQLKKKSCLSMWGCMEANALTMCYRRSLLKVLMSIYLLYKAIYAT,CHRRDLCGSRRSPAYQCGDAEWRPTHLCATGEAYKFVFICFTKPSMLL,VNTEETSVAVKEEVLPINVGMLNGGQRIDYVLQEKPIESFNEYLFALQSHLCY